INSERT INTO sites(host) VALUES('arionmovies.com') 1045: Access denied for user 'www-data'@'localhost' (using password: NO) arionmovies.com Estimated Worth $123,857 - MYIP.NET Website Information
Welcome to MyIP.net!
 Set MYIP as homepage      

  
           

Web Page Information

Title:
Meta Description:
Meta Keywords:
sponsored links:
Links:
Images:
Age:
sponsored links:

Traffic and Estimation

Traffic:
Estimation:

Website Ranks

Alexa Rank:
Google Page Rank:
Sogou Rank:
Baidu Cache:

Search Engine Indexed

Search EngineIndexedLinks
 Google:
 Bing:
 Yahoo!:
 Baidu:
 Sogou:
 Youdao:
 Soso:

Server Data

Web Server:
IP address:    
Location:

Registry information

Registrant:
Email:
ICANN Registrar:
Created:
Updated:
Expires:
Status:
Name Server:
Whois Server:

Alexa Rank and trends

Traffic: Today One Week Avg. Three Mon. Avg.
Rank:
PV:
Unique IP:

More ranks in the world

Users from these countries/regions

Where people go on this site

Alexa Charts

Alexa Reach and Rank

Whois data

Who is arionmovies.com at com.whois-servers.net

Domain Name: ARIONMOVIES.COM

Registry Domain ID: 1256466428_DOMAIN_COM-VRSN

Registrar WHOIS Server: whois.namecheap.com

Registrar URL: http://www.namecheap.com

Updated Date: 2018-08-26T12:28:15Z

Creation Date: 2007-10-05T07:19:25Z

Registry Expiry Date: 2019-10-05T07:19:25Z

Registrar: NameCheap Inc.

Registrar IANA ID: 1068

Registrar Abuse Contact Email: abuse

Registrar Abuse Contact Phone: +1.6613102107

Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited

Name Server: ns1.fuckez.com

Name Server: ns2.fuckez.com

DNSSEC: unsigned

URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

>>> Last update of whois database: 2018-10-04T08:04:02Z <<<



For more information on Whois status codes, please visit https://icann.org/epp



NOTICE:
The expiration date displayed in this record is the date the

registrar's sponsorship of the domain name registration in the registry is

currently set to expire. This date does not necessarily reflect the expiration

date of the domain name registrant's agreement with the sponsoring

registrar. Users may consult the sponsoring registrar's Whois database to

view the registrar's reported date of expiration for this registration.



TERMS OF USE:
You are not authorized to access or query our Whois

database through the use of electronic processes that are high-volume and

automated except as reasonably necessary to register domain names or

modify existing registrations; the Data in VeriSign Global Registry

Services' ("VeriSign") Whois database is provided by VeriSign for

information purposes only, and to assist persons in obtaining information

about or related to a domain name registration record. VeriSign does not

guarantee its accuracy. By submitting a Whois query, you agree to abide

by the following terms of use: You agree that you may use this Data only

for lawful purposes and that under no circumstances will you use this Data

to:
(1) allow, enable, or otherwise support the transmission of mass

unsolicited, commercial advertising or solicitations via e-mail, telephone,

or facsimile; or (2) enable high volume, automated, electronic processes

that apply to VeriSign (or its computer systems). The compilation,

repackaging, dissemination or other use of this Data is expressly

prohibited without the prior written consent of VeriSign. You agree not to

use electronic processes that are automated and high-volume to access or

query the Whois database except as reasonably necessary to register

domain names or modify existing registrations. VeriSign reserves the right

to restrict your access to the Whois database in its sole discretion to ensure

operational stability. VeriSign may restrict or terminate your access to the

Whois database for failure to abide by these terms of use. VeriSign

reserves the right to modify these terms at any time.



The Registry database contains ONLY .COM, .NET, .EDU domains and

Registrars.

Front Page Thumbnail

sponsored links:

Front Page Loading Time

Keyword Hits (Biger,better)

Other TLDs of arionmovies

TLDs Created Expires Registered
.com
.net
.org
.cn
.com.cn
.asia
.mobi

Similar Websites

More...
Alexa鏍囬

Search Engine Spider Emulation

Title:Arion Movies . Com - Free Porn - Sex Tube
Description:Free porn and sex videos available absolutely free on Arion Movies. com! Enter the xxx world of unlimited homemade fuck videos, and you are sure to stay with us for hours!
Keywords:free porn, sex tube, xxx videos, anal sex, indian porn, asian movies
Body:
Arion Movies . Com - Free Porn - Sex Tube
Arion Porn Movies - great website full of never seen before xxx videos available absolutely free! We don't collect old hackneyed videos that you can easily find on any other free resources, but select only the most qualitative clips, which are sure to impress even the most discriminating sex fans. Enter the world of unlimited free porn, and you are sure to stay with us for hours!
Date
-any date-Week Ago
Length
-any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes gt; 90 minutes
Tube
-any tube-aShemaleTubeDrTuberHardsextubeNuvidOverThumbsPornerBrosPornHubSunPornoTube8VID2CXhamsterXVideosXXXKinKyYouPorn
Age
-all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung
Country
-countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish
Teen
338375 Teen Tube Videos
Vintage
30005 Vintage Tube Videos
Japanese
61755 Japanese Tube Videos
Old Young
12680 Old Young Tube Videos
Wife
33079 Wife Tube Videos
Mature
185107 Mature Tube Videos
Lesbian
102319 Lesbian Tube Videos
Voyeur
82830 Voyeur Tube Videos
Shemale
77389 Shemale Tube Videos
Nudist
17045 Nudist Tube Videos
Compilation
9580 Compilation Tube Videos
German
19850 German Tube Videos
Swinger
7482 Swinger Tube Videos
African
5140 African Tube Videos
Mature Amateur
53487 Mature Amateur Tube Videos
Slave
8804 Slave Tube Videos
Orgasm
26873 Orgasm Tube Videos
Masturbating
162985 Masturbating Tube Videos
Seduce
8702 Seduce Tube Videos
Tiny
7334 Tiny Tube Videos
Italian
7384 Italian Tube Videos
Casting
7932 Casting Tube Videos
Hairy
50570 Hairy Tube Videos
Chinese
4681 Chinese Tube Videos
French
13090 French Tube Videos
Bus
2558 Bus Tube Videos
Gangbang
17411 Gangbang Tube Videos
Arabian
6910 Arabian Tube Videos
Sleeping
854 Sleeping Tube Videos
Whip
2517 Whip Tube Videos
18 Year Old
8739 18 Year Old Tube Videos
Spanked
7371 Spanked Tube Videos
Cuckold
15605 Cuckold Tube Videos
Amateur
377014 Amateur Tube Videos
Old Young Lesbian
1119 Old Young Lesbian Tube Videos
Massage
34839 Massage Tube Videos
Bisexual
7546 Bisexual Tube Videos
Cheating
3317 Cheating Tube Videos
Monster Cock
4089 Monster Cock Tube Videos
Russian
34133 Russian Tube Videos
Indian
8741 Indian Tube Videos
Housewife
4802 Housewife Tube Videos
Perverted
11567 Perverted Tube Videos
Handjob
50283 Handjob Tube Videos
Thai
4353 Thai Tube Videos
Creampie
36560 Creampie Tube Videos
Beach
8187 Beach Tube Videos
Story
1430 Story Tube Videos
Gay
152179 Gay Tube Videos
Lesbian Teen
25665 Lesbian Teen Tube Videos
Anal Creampie
9185 Anal Creampie Tube Videos
Classic
7688 Classic Tube Videos
Group Sex
129869 Group Sex Tube Videos
Cash
3552 Cash Tube Videos
Teacher
7342 Teacher Tube Videos
Public
98260 Public Tube Videos
Ugly
489 Ugly Tube Videos
10+ Inch Cock
375 10+ Inch Cock Tube Videos
DPed Anal
3482 DPed Anal Tube Videos
Hermaphrodite
116 Hermaphrodite Tube Videos
Bdsm
76759 Bdsm Tube Videos
Amputee
63 Amputee Tube Videos
Crossdressing
5851 Crossdressing Tube Videos
Party
32110 Party Tube Videos
Husband
3218 Husband Tube Videos
Maid
3253 Maid Tube Videos
Surprise
1330 Surprise Tube Videos
Hypnotized
108 Hypnotized Tube Videos
Babysitter
2426 Babysitter Tube Videos
Saggy Tits
996 Saggy Tits Tube Videos
Nun
477 Nun Tube Videos
Czech
6375 Czech Tube Videos
Prostitute
2743 Prostitute Tube Videos
Mature Lesbian
22407 Mature Lesbian Tube Videos
Hidden Cam
26491 Hidden Cam Tube Videos
Retro
2446 Retro Tube Videos
Ffm
4199 Ffm Tube Videos
Cum In Mouth
7169 Cum In Mouth Tube Videos
Doctor
4481 Doctor Tube Videos
Bondage
12774 Bondage Tube Videos
Orgy
18236 Orgy Tube Videos
Turkish
3833 Turkish Tube Videos
Fisting
11376 Fisting Tube Videos
Humiliation
6162 Humiliation Tube Videos
Mature Teacher
1146 Mature Teacher Tube Videos
Milf
93973 Milf Tube Videos
Natural Boobs
7268 Natural Boobs Tube Videos
Twins
461 Twins Tube Videos
3d
3543 3d Tube Videos
Cinema
295 Cinema Tube Videos
Screaming
1281 Screaming Tube Videos
Gyno Exam
296 Gyno Exam Tube Videos
Submissive
2183 Submissive Tube Videos
Shy
2180 Shy Tube Videos
Transsexual
15550 Transsexual Tube Videos
Filipina
997 Filipina Tube Videos
Panties
15666 Panties Tube Videos
19 Year Old
2448 19 Year Old Tube Videos
Sperm
11138 Sperm Tube Videos
Asian
122803 Asian Tube Videos
British
12873 British Tube Videos
Tranny
93493 Tranny Tube Videos
3some
71799 3some Tube Videos
Tight Pussy
29881 Tight Pussy Tube Videos
Crying
168 Crying Tube Videos
Rocco
592 Rocco Tube Videos
Chubby
10755 Chubby Tube Videos
Throat Fucked
2922 Throat Fucked Tube Videos
Tricked
798 Tricked Tube Videos
Mega Tits
1643 Mega Tits Tube Videos
Egyptian
663 Egyptian Tube Videos
Mistress
14881 Mistress Tube Videos
Riding
25405 Riding Tube Videos
Exhibitionists
1199 Exhibitionists Tube Videos
Spy
4925 Spy Tube Videos
Swedish
1488 Swedish Tube Videos
Barely Legal
11481 Barely Legal Tube Videos
Huge Cock
31203 Huge Cock Tube Videos
Acrobatic
459 Acrobatic Tube Videos
Funny
19223 Funny Tube Videos
Transvestite
1490 Transvestite Tube Videos
Mexican
3264 Mexican Tube Videos
Redhead
25169 Redhead Tube Videos
Stockings
43519 Stockings Tube Videos
College Girl
40458 College Girl Tube Videos
Bukkake
8922 Bukkake Tube Videos
Midget
842 Midget Tube Videos
Club
4938 Club Tube Videos
Humping
5677 Humping Tube Videos
Lap Dancing
179 Lap Dancing Tube Videos
Jerking
19961 Jerking Tube Videos
Strap On
27060 Strap On Tube Videos
Car
7442 Car Tube Videos
Sissy
2564 Sissy Tube Videos
Big Black Cock
25375 Big Black Cock Tube Videos
Milk
3485 Milk Tube Videos
Prostate
657 Prostate Tube Videos
Wrestling
1912 Wrestling Tube Videos
Latex
5895 Latex Tube Videos
Aged
752 Aged Tube Videos
Outdoor
42994 Outdoor Tube Videos
Gloryhole
7442 Gloryhole Tube Videos
Security Cam
59 Security Cam Tube Videos
DPed Pussy
836 DPed Pussy Tube Videos
Sauna
566 Sauna Tube Videos
4some
3921 4some Tube Videos
Secretary
2615 Secretary Tube Videos
Bbw
79913 Bbw Tube Videos
Pantyhose
9515 Pantyhose Tube Videos
Animation
5971 Animation Tube Videos
Vaginal Cumshot
491 Vaginal Cumshot Tube Videos
Ebony
108025 Ebony Tube Videos
Big Tits
214563 Big Tits Tube Videos
Ponyplay
146 Ponyplay Tube Videos
Kitchen
4583 Kitchen Tube Videos
Tied Up
2322 Tied Up Tube Videos
Spit
992 Spit Tube Videos
Asslick
368 Asslick Tube Videos
Assfucking
10130 Assfucking Tube Videos
Argentinian
940 Argentinian Tube Videos
69
4309 69 Tube Videos
Group Orgy
10873 Group Orgy Tube Videos
Twink
15765 Twink Tube Videos
Missionary
8172 Missionary Tube Videos
Flat Chested
283 Flat Chested Tube Videos
Blowjob
539235 Blowjob Tube Videos
Long Hair
1930 Long Hair Tube Videos
Girl Fucks Guy
2981 Girl Fucks Guy Tube Videos
Posing
8162 Posing Tube Videos
Army
537 Army Tube Videos
Ass-To-Mouth
6601 Ass-To-Mouth Tube Videos
Swimsuit
571 Swimsuit Tube Videos
Park Sex
184 Park Sex Tube Videos
Bush
1642 Bush Tube Videos
Garter Belts
661 Garter Belts Tube Videos
Korean
2448 Korean Tube Videos
Face Fucked
4476 Face Fucked Tube Videos
Shaving
1483 Shaving Tube Videos
Socks
1828 Socks Tube Videos
Huge Dildo
4348 Huge Dildo Tube Videos
Pages: 1 2 3 4 5 ... 6747
Today top searches
Search
. 60
. Amateur mature wife
. Amature wife
. Bangla
. Bangladeshi
. Bbc wife amateur
. British lesbian
. Friend fucks my wife
. Fuck my wife
. Hairy nudist
. Indian actress
. Indian college
. Indian hidden cam
. Indian housewife
. Indian marathi
. Indian telugu
. Interracial breeding
. Italian teen
. Jamaican
. Japanese lesbian
. Japanese schoolgirl
. Kannada
. Masturbation hidden cam
. Mature 50
. Muslim
. Old saggy tits
. Public touch
. Rape dad daughter
. Schoolgirl
. Schoolgirl bus
. Self bondage
. Taboo
. Tamil
. Teen bate
. Upskirt no panties
. Very young pussy
. Wife fuck stranger
. Wife gangbang amateur
. Wife masturbating
. Young vintage
Free porn videos
Hot Pornstars Fucking
Search
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
. Alexis Blaze
. Alyssa Milano
. Candi
. Chloe Morgan
. Dany
. Dina Jewel
. Esther
. Evie Delatosso
. Heather Summers
. Jean Pierre
. Jenni
. Jeremy Stevens
. Kapri
. Kelly Roshe
. Laisa
. Lana Ivans
. Leah Livingston
. Lyn
. Maica Hase
. Milan Sterling
. Miyama Ranko
. Molly Douglas
. Nadia Nyce
. Natalie Nightly
. Natasha Starr
. Nyomi Marcella
. Paris
. Rimka
. Ryo Tsujimoto
. Sensi
. Subrina
. Topanga Fox
Top List of Porn Tube Sites
1-40
01Porn Hub Com
02Kinky Gonzo Porn
03New Sex TV
04Naked Wife Porn
05Nice Sex Tube
06Cash Video Tube
07Hairy Tube
08Hard Porn
09Sex Tube Films
10Hot Sex Tube
11Free Porno
12Korean Porn Tube
13Hot Free Xxx
14U Xxx Tube
15Rulertube
16Movie Mo
17Goblins Tube
18Anal Xxx Tube
19Dildo Xxx Tube
20Free Moms Sex
21Xxx Fuck Porn
22Porn Sun Shine
2321 Pornhub
24XNXX Movies
25Xhamster
26Hot Milf Clips
27Matures Naked
28Slutty Daddy
29Mommy Sex Movies
30Anal Sex Tube
31Wife Porno Movies
32Xxx Matures Tube
33Free Xxx Clips
34Free Fuck Mom
35Japan Hd Porn
36Sex Tube Club
37Extreme Fetish Videos
38Cumshot Porn Movies
39Video You Tube
40Diamond Tubes
41-80
41Free Online Porn
42La Xxx Porn
43My Xxx Movies
44Porno Videos
45Hard Porn
46My Retro Tube
47Mrs Sex Tube
48Pipe Porn Tube
49Porn Tube Archive
50Hq Sex Tubes
51Best Xxx Fuck
52Xhamster Porn
53Xvideos Sex
54Mature Nude Porn
55Fuck Porn Xxx
56QoQ Tube
57Plumper Xxx Videos
58Filth Matures
59Kaza Porn Tube
60Stolen Wifes
61Hot Fuck Films
62Live Granny
63XiX Porn Tube
64Homemade Videos
65Boss Video
66Mag Post
67Free Sex Tube
68Porn I Wank
69Xxx Sex Anal
70Hardcore Xxx Tube
71Mommy Fuck Tube
72Pink Dino
73Free Milf Videos
74DT Video
75Xxx Sex Fuck
76Home Private Vids
77Free Sex Videos
78Porn Setup
79Sex Tube Fuck
80Fuck Tube Movies
81-120
81Dads Sex Videos
82Tapir Porn Tube
83Sfico Tube
84Best Sex Tube
85Free Pornstars Top
86
87Real Asian Porn
88
89Mature Free Porn
90Sexy Sluts
91Free Iphone Porn
92
93Best Porn Tube
94Matures Anal Videos
95Lesbian Mature Porn
96Bbw Porn Tube
97Free Latin Porn
98Xxx Tube Free
99Anal Sex Films
100Xxx Tube Host
101Fuck Videos
102Tube Home Porn
103Mommy Porn Tube
104
105Free Hd Porn
106Xxx Online Porn
107Free Sex Xxx
108Free Fuck Porn
109
110
111Granny Sex Movs
112All Fuck Tube
113Movs Porn Tube
114Place of Porn
115Anal Sex Tube
116Cum Comes
117Cute Porn TV
118Pornesto
119Hd Porn
120Ice Porn
121-160
121Porn Tube Boobs
122Voyeur Sex Films
123Video One
124AzA Porn Tube
125Flamingo Tube
126Free Gonzo
127Crunk Movies
128Dwarfs Tube
129
130Perky Wives
131KeX Tube
132Stream Sex
133KoK Porn Tube
134Free Porn Tube
135Car Tube Video
136Beeg Porn Tube
137Spy Videos Tubes
138Older Mom Tube
139Granny Porn Videos
140Large Fuck Tube
141Beeg Tube
142Hardsextube Porn
143Moms Fuck
144Mommy Porno Videos
145Vintage Porn Videos
146Matures Fuck Tube
147Suck Porn Tube
148Try Free Porn
149Mature Videos Porn
150Free Xxx Movies
151Redtube Porn
152Youporn.com
153Paris Tube Porn
154Pornhub
155Mom Tube Sex
156Wow Fuck Tube
157Xxx Tube Movies
158
159
160
161-200
161
162
163
164
165
166
167
168
169
170
171
172
173
174
175
176
177
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200
We do not own, produce or host the Teen videos displayed on this website.
All of the Teen videos displayed here are hosted by websites that are not under our control
Abuse - Free Porn - World Hd Porn

Updated Time

Updating   
Friend links: ProxyFire    More...
Site Map 1 2 3 4 5 6 7 8 9 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 250 300 350 400 450 500 550 600 610 620 630 640 650 660 670 680 690 700 710 720 730 740 750
TOS | Contact us
© 2009 MyIP.cn Dev by MYIP Elapsed:69.930ms