INSERT INTO sites(host) VALUES('arionmovies.com') 1045: Access denied for user 'www-data'@'localhost' (using password: NO) arionmovies.com Estimated Worth $460,959 - MYIP.NET Website Information
Welcome to MyIP.net!
 Set MYIP as homepage      

  
           

Web Page Information

Title:
Meta Description:
Meta Keywords:
sponsored links:
Links:
Images:
Age:
sponsored links:

Traffic and Estimation

Traffic:
Estimation:

Website Ranks

Alexa Rank:
Google Page Rank:
Sogou Rank:
Baidu Cache:

Search Engine Indexed

Search EngineIndexedLinks
 Google:
 Bing:
 Yahoo!:
 Baidu:
 Sogou:
 Youdao:
 Soso:

Server Data

Web Server:
IP address:    
Location:

Registry information

Registrant:
Email:
ICANN Registrar:
Created:
Updated:
Expires:
Status:
Name Server:
Whois Server:

Alexa Rank and trends

Traffic: Today One Week Avg. Three Mon. Avg.
Rank:
PV:
Unique IP:

More ranks in the world

Users from these countries/regions

Where people go on this site

Alexa Charts

Alexa Reach and Rank

Whois data

Who is arionmovies.com at com.whois-servers.net

Domain Name: ARIONMOVIES.COM

Registry Domain ID: 1256466428_DOMAIN_COM-VRSN

Registrar WHOIS Server: whois.namecheap.com

Registrar URL: http://www.namecheap.com

Updated Date: 2018-08-26T12:28:15Z

Creation Date: 2007-10-05T07:19:25Z

Registry Expiry Date: 2019-10-05T07:19:25Z

Registrar: NameCheap, Inc.

Registrar IANA ID: 1068

Registrar Abuse Contact Email: abuse

Registrar Abuse Contact Phone: +1.6613102107

Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited

Name Server: ns1.fuckez.com

Name Server: ns2.fuckez.com

DNSSEC: unsigned

URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

>>> Last update of whois database: 2018-12-08T20:28:22Z <<<



For more information on Whois status codes, please visit https://icann.org/epp



NOTICE:
The expiration date displayed in this record is the date the

registrar's sponsorship of the domain name registration in the registry is

currently set to expire. This date does not necessarily reflect the expiration

date of the domain name registrant's agreement with the sponsoring

registrar. Users may consult the sponsoring registrar's Whois database to

view the registrar's reported date of expiration for this registration.



TERMS OF USE:
You are not authorized to access or query our Whois

database through the use of electronic processes that are high-volume and

automated except as reasonably necessary to register domain names or

modify existing registrations; the Data in VeriSign Global Registry

Services' ("VeriSign") Whois database is provided by VeriSign for

information purposes only, and to assist persons in obtaining information

about or related to a domain name registration record. VeriSign does not

guarantee its accuracy. By submitting a Whois query, you agree to abide

by the following terms of use: You agree that you may use this Data only

for lawful purposes and that under no circumstances will you use this Data

to:
(1) allow, enable, or otherwise support the transmission of mass

unsolicited, commercial advertising or solicitations via e-mail, telephone,

or facsimile; or (2) enable high volume, automated, electronic processes

that apply to VeriSign (or its computer systems). The compilation,

repackaging, dissemination or other use of this Data is expressly

prohibited without the prior written consent of VeriSign. You agree not to

use electronic processes that are automated and high-volume to access or

query the Whois database except as reasonably necessary to register

domain names or modify existing registrations. VeriSign reserves the right

to restrict your access to the Whois database in its sole discretion to ensure

operational stability. VeriSign may restrict or terminate your access to the

Whois database for failure to abide by these terms of use. VeriSign

reserves the right to modify these terms at any time.



The Registry database contains ONLY .COM, .NET, .EDU domains and

Registrars.

Front Page Thumbnail

sponsored links:

Front Page Loading Time

Keyword Hits (Biger,better)

Other TLDs of arionmovies

TLDs Created Expires Registered
.com
.net
.org
.cn
.com.cn
.asia
.mobi

Similar Websites

More...
Alexa鏍囬

Search Engine Spider Emulation

Title:Arion Movies . Com - Free Porn - Sex Tube
Description:Free porn and sex videos available absolutely free on Arion Movies. com! Enter the xxx world of unlimited homemade fuck videos, and you are sure to stay with us for hours!
Keywords:free porn, sex tube, xxx videos, anal sex, indian porn, asian movies
Body:
Arion Movies . Com - Free Porn - Sex Tube
Arion Porn Movies - great website full of never seen before xxx videos available absolutely free! We don't collect old hackneyed videos that you can easily find on any other free resources, but select only the most qualitative clips, which are sure to impress even the most discriminating sex fans. Enter the world of unlimited free porn, and you are sure to stay with us for hours!
Date
-any date-
Length
-any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes gt; 90 minutes
Tube
-any tube-HardsextubeRedTubeTube8VID2CXhamsterXVideosXXXKinKy
Age
-all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung
Country
-countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish
Teen
265263 Teen Tube Videos
Wife
49955 Wife Tube Videos
Old Young
24139 Old Young Tube Videos
Mature
238668 Mature Tube Videos
Vintage
32946 Vintage Tube Videos
Forced
603 Forced Tube Videos
Home Made
38215 Home Made Tube Videos
Japanese
53811 Japanese Tube Videos
Lesbian
86520 Lesbian Tube Videos
Mature Amateur
78359 Mature Amateur Tube Videos
Voyeur
102209 Voyeur Tube Videos
Anal
162624 Anal Tube Videos
Russian
31193 Russian Tube Videos
German
25488 German Tube Videos
Shemale
40785 Shemale Tube Videos
Hairy
45550 Hairy Tube Videos
Casting
8410 Casting Tube Videos
Compilation
10879 Compilation Tube Videos
Creampie
38662 Creampie Tube Videos
Amateur
449737 Amateur Tube Videos
Retro
2940 Retro Tube Videos
Hidden Cam
34430 Hidden Cam Tube Videos
Italian
8093 Italian Tube Videos
Massage
19215 Massage Tube Videos
Old Man
3882 Old Man Tube Videos
Orgasm
24473 Orgasm Tube Videos
Cuckold
18645 Cuckold Tube Videos
Slave
9692 Slave Tube Videos
Milf
110095 Milf Tube Videos
Gangbang
18676 Gangbang Tube Videos
18 Year Old
5005 18 Year Old Tube Videos
Indian
11625 Indian Tube Videos
Interracial
83408 Interracial Tube Videos
Arabian
8713 Arabian Tube Videos
Swinger
9476 Swinger Tube Videos
Public
83446 Public Tube Videos
Tiny
4937 Tiny Tube Videos
Gay
200023 Gay Tube Videos
Monster Cock
2394 Monster Cock Tube Videos
Housewife
9321 Housewife Tube Videos
Surprise
1270 Surprise Tube Videos
3some
62295 3some Tube Videos
French
15671 French Tube Videos
Masturbating
175792 Masturbating Tube Videos
Seduce
5225 Seduce Tube Videos
Handjob
48439 Handjob Tube Videos
Spanked
8730 Spanked Tube Videos
British
16762 British Tube Videos
Chinese
4593 Chinese Tube Videos
Bus
2194 Bus Tube Videos
Chubby
14796 Chubby Tube Videos
Bbw
88957 Bbw Tube Videos
Cheating
4930 Cheating Tube Videos
Perverted
14295 Perverted Tube Videos
Old Young Lesbian
1759 Old Young Lesbian Tube Videos
Big Tits
184201 Big Tits Tube Videos
Mature Lesbian
24962 Mature Lesbian Tube Videos
African
6281 African Tube Videos
Clit
15416 Clit Tube Videos
Classic
8468 Classic Tube Videos
Thai
5079 Thai Tube Videos
Ugly
736 Ugly Tube Videos
Bdsm
86663 Bdsm Tube Videos
Fisting
10995 Fisting Tube Videos
DPed Anal
3827 DPed Anal Tube Videos
Party
18054 Party Tube Videos
Nudist
17815 Nudist Tube Videos
10+ Inch Cock
337 10+ Inch Cock Tube Videos
Webcam
74852 Webcam Tube Videos
Hermaphrodite
108 Hermaphrodite Tube Videos
Orgy
13342 Orgy Tube Videos
Spy
7187 Spy Tube Videos
Asian
111213 Asian Tube Videos
Cum In Mouth
8675 Cum In Mouth Tube Videos
Transsexual
10454 Transsexual Tube Videos
Game
3494 Game Tube Videos
Tranny
46950 Tranny Tube Videos
Gloryhole
5092 Gloryhole Tube Videos
Anal Creampie
10433 Anal Creampie Tube Videos
Story
1638 Story Tube Videos
Big Black Cock
22067 Big Black Cock Tube Videos
Maid
3159 Maid Tube Videos
Whip
2504 Whip Tube Videos
Bisexual
10664 Bisexual Tube Videos
Saggy Tits
1787 Saggy Tits Tube Videos
Strap On
27734 Strap On Tube Videos
Lesbian Teen
18141 Lesbian Teen Tube Videos
Stockings
32518 Stockings Tube Videos
Beach
8195 Beach Tube Videos
Shy
2269 Shy Tube Videos
Humiliation
6314 Humiliation Tube Videos
Sleeping
603 Sleeping Tube Videos
Husband
3683 Husband Tube Videos
Exhibitionists
1109 Exhibitionists Tube Videos
Crying
203 Crying Tube Videos
Sex Tape
5716 Sex Tape Tube Videos
Doggystyle
43676 Doggystyle Tube Videos
Cash
2350 Cash Tube Videos
Mature Teacher
1498 Mature Teacher Tube Videos
Boss
2271 Boss Tube Videos
Cinema
259 Cinema Tube Videos
Couple
92749 Couple Tube Videos
3d
2994 3d Tube Videos
Midget
875 Midget Tube Videos
Nun
449 Nun Tube Videos
Turkish
5000 Turkish Tube Videos
Czech
6175 Czech Tube Videos
Teacher
6198 Teacher Tube Videos
Pantyhose
7031 Pantyhose Tube Videos
Funny
19401 Funny Tube Videos
Doctor
4173 Doctor Tube Videos
Upskirt
16316 Upskirt Tube Videos
Outdoor
31375 Outdoor Tube Videos
Big Cock
99723 Big Cock Tube Videos
Bukkake
8914 Bukkake Tube Videos
Sauna
594 Sauna Tube Videos
Cum
109179 Cum Tube Videos
19 Year Old
2453 19 Year Old Tube Videos
Blowjob
466277 Blowjob Tube Videos
Sperm
13776 Sperm Tube Videos
Gyno Exam
196 Gyno Exam Tube Videos
Cumshot
114154 Cumshot Tube Videos
Group Sex
109259 Group Sex Tube Videos
69
4034 69 Tube Videos
Vaginal Cumshot
518 Vaginal Cumshot Tube Videos
Twink
22673 Twink Tube Videos
Spanish
2777 Spanish Tube Videos
Hypnotized
85 Hypnotized Tube Videos
Brazilian
13135 Brazilian Tube Videos
Solo
49978 Solo Tube Videos
Cleaner
1640 Cleaner Tube Videos
Security Cam
102 Security Cam Tube Videos
Asslick
399 Asslick Tube Videos
Car
6277 Car Tube Videos
Pain
984 Pain Tube Videos
Crossdressing
8106 Crossdressing Tube Videos
Hardcore
244931 Hardcore Tube Videos
Adultery
941 Adultery Tube Videos
Double Blowjob
7639 Double Blowjob Tube Videos
4some
2765 4some Tube Videos
Twins
591 Twins Tube Videos
Babe
148824 Babe Tube Videos
Bizarre
16655 Bizarre Tube Videos
Nude
23629 Nude Tube Videos
Argentinian
1393 Argentinian Tube Videos
Big Nipples
6260 Big Nipples Tube Videos
Dped
6366 Dped Tube Videos
American
5631 American Tube Videos
Shower
10191 Shower Tube Videos
Nerdy
2177 Nerdy Tube Videos
Aged
4303 Aged Tube Videos
Redhead
22679 Redhead Tube Videos
Adorable
29168 Adorable Tube Videos
Sybian
510 Sybian Tube Videos
Messy Facials
721 Messy Facials Tube Videos
Amputee
68 Amputee Tube Videos
Machines
4396 Machines Tube Videos
Lesbian Gangbang
220 Lesbian Gangbang Tube Videos
Flasher
19936 Flasher Tube Videos
Glamour
6300 Glamour Tube Videos
Transvestite
4177 Transvestite Tube Videos
Wedding
401 Wedding Tube Videos
Lactating
822 Lactating Tube Videos
Dildo
41030 Dildo Tube Videos
Huge Dildo
4017 Huge Dildo Tube Videos
Missionary
6839 Missionary Tube Videos
Korean
2861 Korean Tube Videos
Nipples
13523 Nipples Tube Videos
Cum Swallowing
7424 Cum Swallowing Tube Videos
Acrobatic
400 Acrobatic Tube Videos
Stupid Girl
17 Stupid Girl Tube Videos
Lap Dancing
240 Lap Dancing Tube Videos
Squirt
15203 Squirt Tube Videos
Natural Boobs
6274 Natural Boobs Tube Videos
Nurse
4579 Nurse Tube Videos
Huge Cock
25373 Huge Cock Tube Videos
Filipina
1540 Filipina Tube Videos
Hd
141542 Hd Tube Videos
Latex
6005 Latex Tube Videos
Greek
859 Greek Tube Videos
Pages: 1 2 3 4 5 ... 6325
Today top searches
Search
. Africa boy
. African big
. Amateur wife dp
. Arab anal
. Arabian hijab
. Breasts
. Bus asian
. Domina shemale
. Friend fucks my wife
. Gangbang cartoon
. Granny amateur
. Hollywood celebs sex
. Indian actress
. Indian massage
. Indian mature
. Italian teen
. Janet black
. Japanese massage
. Kannada
. Ladies kiss
. Lesbian tribbing
. Maid masturbates
. Mature french
. Mother
. Old young lez
. Orgy
. Punjabi
. Pussy spreading solo
. Real life cam
. Sex arab
. Shoplifter
. Sister
. Slave teen anal
. Super girl
. Teen swinger
. Vintage nudist
. Wife anal
. Wife punished
. Wife sharing
. Young bbc wife
Free porn videos
Hot Pornstars Fucking
Search
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
. Alexandra Belle
. Amazon
. Amylee
. Araynna Star
. Armani
. Avery Brooks
. Bianca Hill
. Dahlia
. Dee
. Gia Grace
. Giselle Humes
. Giulia
. Jade Starr
. Judy Starr
. Juliana Di Primo
. Kiara Lord
. Kung
. Mallory Rae Murphy
. Mimi Rayne
. Niki
. Nora Skyy
. Pepper
. Rae
. Rosie
. Serge
. Tatum Pierce
. Taylor Whyte
. Tommie Jo
. Winnie
Top List of Porn Tube Sites
1-40
01Rulertube
02My Retro Tube
03Hot Sex Tube
04Cash Video Tube
05Nice Sex Tube
06Xxx Tube Movies
07Free Sex Tube
08Kinky Gonzo Porn
09Ice Porn
10Mom Tube Sex
11Video One
12Movie Mo
13Hard Porn
14Tapir Porn Tube
15Free Porn Tube
16Fuck Tube Movies
17Goblins Tube
18Lesbian Mature Porn
19Free Sex Xxx
20Matures Naked
21Bbw Tube Sex
22Mag Post
23Free Moms Sex
24DT Video
25Stream Sex
26Live Granny
27Porn Tube Archive
28Vintage Porn Videos
29U Xxx Tube
30XiX Porn Tube
31Free Fuck Mom
32Xvideos Sex
33Dildo Xxx Tube
34Kaza Porn Tube
35Xxx Matures Tube
36Porn Sun Shine
37Pipe Porn Tube
38XNXX Movies
39Movs Porn Tube
40Xhamster Porn
41-80
41Fuck Videos
42Try Free Porn
43Free Sex Videos
44Youporn.com
45Fuck Porn Xxx
46Free Fuck Porn
47My Xxx Movies
48Porno Videos
49Mommy Fuck Tube
50Mommy Porno Videos
51Xhamster
52Porn Hub Com
53Hot Milf Clips
54Hq Sex Tubes
55Mature Videos Porn
56Best Xxx Fuck
57KoK Porn Tube
58Stolen Wifes
59Slutty Daddy
60Filth Matures
61KeX Tube
62QoQ Tube
63Sexy Sluts
64Dwarfs Tube
65Xhamster
66Free Gonzo
67Boo Loo
68Beeg Porn Tube
69Pink Dino
70Sex Tube Films
71Home Private Vids
72Hardsextube Porn
73Best Sex Tube
74Naked Wife Porn
75Cute Porn TV
76Xxx Fuck Porn
77Xxx Sex Anal
78Xxx Tube Free
79Hairy Tube
80Sex Tube Fuck
81-120
81Granny Sex Movs
82Korean Porn Tube
83Mature Free Porn
84Real Asian Porn
85Porn Tube Videos
86Matures Anal Videos
87Free Iphone Porn
88Japan Xxx Movies
89Public Xxx Videos
90Best Porn Tube
91
92
93Sex Tube Videos
94Amateur Free Porn
95Cumshot Porn Movies
96Pornstar Tube Xxx
97Black Tube Xxx
98Wife Porn Story
99Tube Home Porn
100Xxx Tube Host
101Free Online Porn
102Bbw Porn Tube
103Free Latin Porn
104Japan Hd Porn
105Free Pornstars Top
106Porn I Wank
107Hardcore Xxx Tube
108Free Hd Porn
109Anal Sex Films
110Free Xxx Clips
111Porn Setup
112Mommy Porn Tube
113La Xxx Porn
114Wow Fuck Tube
115All Fuck Tube
116Anal Xxx Tube
117
118Cum Comes
119Pornesto
120Hd Porn
121-160
121Porn Tube Boobs
122Voyeur Sex Films
123Free Milf Videos
124Xxx Sex Fuck
125Sex Tube Club
126Diamond Tubes
127Video You Tube
128Sfico Tube
129Dads Sex Videos
130AzA Porn Tube
131Flamingo Tube
132Crunk Movies
133pornorama
134Perky Wives
135Mommy Sex Movies
136Hot Fuck Films
137Free Porno
138Car Tube Video
139Boss Video
140Homemade Videos
141New Sex TV
14221 Pornhub
143Spy Videos Tubes
144Older Mom Tube
145Granny Porn Videos
146Large Fuck Tube
147Moms Fuck
148Matures Fuck Tube
149Suck Porn Tube
150Plumper Xxx Videos
151Free Xxx Movies
152Redtube Porn
153Mature Nude Porn
154Paris Tube Porn
155Pornhub
156Wife Porno Movies
157Mrs Sex Tube
158Anal Sex Tube
159Hard Porn
160
161-200
161
162
163
164
165
166
167
168
169
170
171
172
173
174
175
176
177
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200
We do not own, produce or host the Teen videos displayed on this website.
All of the Teen videos displayed here are hosted by websites that are not under our control
Abuse - Free Porn - World Hd Porn

Updated Time

Updating   
Friend links: ProxyFire    More...
Site Map 1 2 3 4 5 6 7 8 9 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 250 300 350 400 450 500 550 600 610 620 630 640 650 660 670 680 690 700 710 720 730 740 750
TOS | Contact us
© 2009 MyIP.cn Dev by MYIP Elapsed:33.319ms